Recombinant Human ARG1, His-tagged
Cat.No. : | ARG1-28658TH |
Product Overview : | Recombinant full length Human liver Arginase with His tag at the C terminus; 330 aa, 35.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 322 amino acids |
Description : | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 35.800kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.58% Sodium phosphate, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKL KEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM TEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP PKLEHHHHHH |
Sequence Similarities : | Belongs to the arginase family. |
Gene Name | ARG1 arginase, liver [ Homo sapiens ] |
Official Symbol | ARG1 |
Synonyms | ARG1; arginase, liver; arginase-1; |
Gene ID | 383 |
mRNA Refseq | NM_000045 |
Protein Refseq | NP_000036 |
MIM | 608313 |
Uniprot ID | P05089 |
Chromosome Location | 6q23 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; |
Function | arginase activity; hydrolase activity; manganese ion binding; metal ion binding; |
◆ Recombinant Proteins | ||
Arg1-1524R | Recombinant Rat Arg1 protein, His-tagged | +Inquiry |
ARG1-28658TH | Recombinant Human ARG1, His-tagged | +Inquiry |
Arg1-3622R | Recombinant Rat Arg1, His-tagged | +Inquiry |
ARG1-2961H | Recombinant Human ARG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARG1-756H | Recombinant Human ARG1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-150R | Active Native Rat Arginase | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *
0
Inquiry Basket