Recombinant Human ARFRP1 protein, GST-tagged

• Cat.No.: ARFRP1-755H
• Product Overview: Human ARFRP1 full-length ORF ( NP_003215, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012]
• Molecular Mass: 47.74 kDa
• AA Sequence: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARFRP1 ADP-ribosylation factor related protein 1 [ Homo sapiens ]
• Official Symbol: ARFRP1
• Synonyms: ARFRP1; ADP-ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARL18; ARP; Arp1; SCG10 like-protein; ARF-related protein 1; helicase-like protein NHL
• Gene ID: 10139
• mRNA Refseq: NM_001134758
• Protein Refseq: NP_001128230
• MIM: 604699
• UniProt ID: Q13795