Recombinant Human ARFIP2 protein, T7-tagged

Cat.No. : ARFIP2-156H
Product Overview : Recombinant human Arfaptin-2 (341aa, Isoform_II) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 341 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRE TKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKF LEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ]
Official Symbol ARFIP2
Synonyms ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; partner of RAC1 (arfaptin 2); FLJ18046; FLJ18697; FLJ99239;
Gene ID 23647
mRNA Refseq NM_001242854
Protein Refseq NP_001229783
MIM 601638
UniProt ID P53365
Chromosome Location 11p15
Pathway Arf1 pathway, organism-specific biosystem;
Function GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARFIP2 Products

Required fields are marked with *

My Review for All ARFIP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon