Recombinant Human ARFGEF1 protein, GST-tagged

• Cat.No.: ARFGEF1-752H
• Product Overview: Human ARFGEF1 partial ORF ( NP_006412.2, 311 a.a. - 411 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP. It contains a Sec7 domain, which may be responsible for guanine-nucleotide exchange activity and also brefeldin A inhibition. [provided by RefSeq, Aug 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARFGEF1 ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited) [ Homo sapiens ]
• Official Symbol: ARFGEF1
• Synonyms: ARFGEF1; ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited); brefeldin A-inhibited guanine nucleotide-exchange protein 1; ARFGEP1; BIG1; DKFZP434L057; p200; p200 ARF guanine nucleotide exchange factor; P200
• Gene ID: 10565
• mRNA Refseq: NM_006421
• Protein Refseq: NP_006412
• MIM: 604141
• UniProt ID: Q9Y6D6