Recombinant Human ARF5 protein, GST-tagged
Cat.No. : | ARF5-748H |
Product Overview : | Human ARF5 full-length ORF ( NP_001653.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARF5 ADP-ribosylation factor 5 [ Homo sapiens ] |
Official Symbol | ARF5 |
Synonyms | ARF5; ADP-ribosylation factor 5; |
Gene ID | 381 |
mRNA Refseq | NM_001662 |
Protein Refseq | NP_001653 |
MIM | 103188 |
UniProt ID | P84085 |
◆ Recombinant Proteins | ||
ARF5-9802H | Recombinant Human ARF5, GST-tagged | +Inquiry |
ARF5-748H | Recombinant Human ARF5 protein, GST-tagged | +Inquiry |
ARF5-198H | Recombinant Human ARF5, His tagged | +Inquiry |
Arf5-3209R | Recombinant Rat Arf5, His-tagged | +Inquiry |
ARF5-3583H | Recombinant Human ARF5 protein(Met1-Arg180), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF5-8757HCL | Recombinant Human ARF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARF5 Products
Required fields are marked with *
My Review for All ARF5 Products
Required fields are marked with *
0
Inquiry Basket