Recombinant Human ARAF protein, His-tagged

• Cat.No.: ARAF-186H
• Product Overview: Recombinant Human ARAF(225 - 324 aa) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Description: This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
• Source: E. coli
• Species: Human
• Tag: His
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• Protein length: 225 - 324 aa
• AA Sequence: STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGY RDSGYYWEVPPSEVQLLKRIGTGSF
• Purity: > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Gene Information

• Gene Name: ARAF v-raf murine sarcoma 3611 viral oncogene homolog [ Homo sapiens ]
• Official Symbol: ARAF
• Synonyms: ARAF; v-raf murine sarcoma 3611 viral oncogene homolog; ARAF1, v raf murine sarcoma 3611 viral oncogene homolog 1; serine/threonine-protein kinase A-Raf; Oncogene ARAF1; proto-oncogene Pks; proto-oncogene A-Raf-1; Ras-binding protein DA-Raf; v-raf murine sarcoma 3611 viral oncogene homolog 1; A-Raf proto-oncogene serine/threonine-protein kinase; PKS2; A-RAF; ARAF1; RAFA1
• Gene ID: 369
• mRNA Refseq: NM_001256196
• Protein Refseq: NP_001243125
• MIM: 311010
• UniProt ID: P10398
• Chromosome Location: Xp11.3-p11.23
• Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Colorectal cancer, organism-specific biosystem
• Function: ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor signaling protein activity