Recombinant Human AR protein, His-tagged

Cat.No. : AR-993H
Product Overview : Recombinant Human AR protein(P10275)(559-671aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 559-671aa
Tag : N-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Molecular Mass : 18.6kDa
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ
Gene Name AR androgen receptor [ Homo sapiens ]
Official Symbol AR
Synonyms AR; androgen receptor; DHTR, dihydrotestosterone receptor , SBMA, spinal and bulbar muscular atrophy; AIS; HUMARA; Kennedy disease; NR3C4; SMAX1; testicular feminization; dihydrotestosterone receptor; androgen nuclear receptor variant 2; nuclear receptor subfamily 3 group C member 4; KD; TFM; DHTR; SBMA; HYSP1;
Gene ID 367
mRNA Refseq NM_000044
Protein Refseq NP_000035
MIM 313700
UniProt ID P10275

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AR Products

Required fields are marked with *

My Review for All AR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon