Recombinant Human AQP6 protein, GST-tagged

Cat.No. : AQP6-301468H
Product Overview : Recombinant Human AQP6 (221-282 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met221-Val282
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name AQP6 aquaporin 6, kidney specific [ Homo sapiens ]
Official Symbol AQP6
Synonyms AQP6; aquaporin 6, kidney specific; AQP2L; aquaporin-6; hKID; AQP-6; kidney-specific aquaporin; aquaporin-6, kidney specific; aquaporin 2-like, kidney specific; KID;
Gene ID 363
mRNA Refseq NM_001652
Protein Refseq NP_001643
MIM 601383
UniProt ID Q13520

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AQP6 Products

Required fields are marked with *

My Review for All AQP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon