Recombinant Human AQP4 Protein, His-SUMO-tagged

• Cat.No.: AQP4-1131H
• Product Overview: Recombinant Human AQP4 Protein (253-323aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 253-323 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 24 kDa
• AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: AQP4 aquaporin 4 [ Homo sapiens ]
• Official Symbol: AQP4
• Synonyms: AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454
• Gene ID: 361
• mRNA Refseq: NM_001650
• Protein Refseq: NP_001641
• MIM: 600308
• UniProt ID: P55087