Recombinant Human AQP4 Protein, His-SUMO-tagged

Cat.No. : AQP4-1131H
Product Overview : Recombinant Human AQP4 Protein (253-323aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 253-323 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24 kDa
AA Sequence : CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name AQP4 aquaporin 4 [ Homo sapiens ]
Official Symbol AQP4
Synonyms AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454
Gene ID 361
mRNA Refseq NM_001650
Protein Refseq NP_001641
MIM 600308
UniProt ID P55087

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AQP4 Products

Required fields are marked with *

My Review for All AQP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon