Recombinant Human APOOL protein, GST-tagged
Cat.No. : | APOOL-720H |
Product Overview : | Human APOOL full-length ORF ( NP_940852.3, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. [provided by RefSeq, Sep 2011] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOOL apolipoprotein O-like [ Homo sapiens ] |
Official Symbol | APOOL |
Synonyms | APOOL; apolipoprotein O-like; chromosome X open reading frame 33 , CXorf33, FAM121A, family with sequence similarity 121A; AAIR8193; UNQ8193; family with sequence similarity 121A; CXorf33; FAM121A; MGC129748; |
Gene ID | 139322 |
mRNA Refseq | NM_198450 |
Protein Refseq | NP_940852 |
UniProt ID | Q6UXV4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All APOOL Products
Required fields are marked with *
My Review for All APOOL Products
Required fields are marked with *
0
Inquiry Basket