Recombinant Human APOL4 protein, GST-tagged

• Cat.No.: APOL4-714H
• Product Overview: Human APOL4 full-length ORF ( ENSP00000331089, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.7 kDa
• AA Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOL4 apolipoprotein L, 4 [ Homo sapiens ]
• Official Symbol: APOL4
• Synonyms: APOL4; apolipoprotein L, 4; apolipoprotein L4; APOLIV; apolipoprotein L-IV; APOL-IV
• Gene ID: 80832
• mRNA Refseq: NM_030643
• Protein Refseq: NP_085146
• MIM: 607254
• UniProt ID: Q9BPW4