Recombinant Human APOC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : APOC2-1776H
Product Overview : APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
Molecular Mass : 11.2 kDa
AA Sequence : MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name APOC2 apolipoprotein C-II [ Homo sapiens (human) ]
Official Symbol APOC2
Synonyms APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082;
Gene ID 344
mRNA Refseq NM_000483
Protein Refseq NP_000474
MIM 608083
UniProt ID P02655

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APOC2 Products

Required fields are marked with *

My Review for All APOC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon