Recombinant Human APOC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: APOC2-1776H
• Product Overview: APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.2 kDa
• AA Sequence: MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: APOC2 apolipoprotein C-II [ Homo sapiens (human) ]
• Official Symbol: APOC2
• Synonyms: APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082
• Gene ID: 344
• mRNA Refseq: NM_000483
• Protein Refseq: NP_000474
• MIM: 608083
• UniProt ID: P02655