Recombinant Human APOC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | APOC2-1776H |
Product Overview : | APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | APOC2 apolipoprotein C-II [ Homo sapiens (human) ] |
Official Symbol | APOC2 |
Synonyms | APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082; |
Gene ID | 344 |
mRNA Refseq | NM_000483 |
Protein Refseq | NP_000474 |
MIM | 608083 |
UniProt ID | P02655 |
◆ Recombinant Proteins | ||
APOC2-196R | Recombinant Rhesus Macaque APOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Apoc2-2087M | Recombinant Mouse Apoc2 protein, His & GST-tagged | +Inquiry |
APOC2-2085H | Recombinant Horse APOC2 protein, His & T7-tagged | +Inquiry |
Apoc2-2086G | Recombinant Guinea pig Apoc2 protein, His & GST-tagged | +Inquiry |
APOC2-0595H | Recombinant Human APOC2 Protein (Gly22-Glu101), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-27332TH | Native Human APOC2 | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC2-8783HCL | Recombinant Human APOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC2 Products
Required fields are marked with *
My Review for All APOC2 Products
Required fields are marked with *
0
Inquiry Basket