Recombinant Human APOC2 Protein, His-tagged

• Cat.No.: APOC2-916H
• Product Overview: Recombinant Human APOC2 fused with His tag at C-terminal was expressed in E. coli.

Specification

• Description: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
• Source: E. coli
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of PBS, 30%glycerol, pH7.4
• Molecular Mass: 10kD
• AA Sequence: MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: APOC2 apolipoprotein C-II [ Homo sapiens ]
• Official Symbol: APOC2
• Synonyms: APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082
• Gene ID: 344
• mRNA Refseq: NM_000483
• Protein Refseq: NP_000474
• MIM: 608083
• UniProt ID: P02655