Recombinant Human APOC1 protein, N/A-tagged

• Cat.No.: APOC1-2537H
• Product Overview: Recombinant Human APOC1 protein(P02654)(27-83aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 27-83aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 6.6 kDa
• AA Sequence: TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: APOC1 apolipoprotein C-I [ Homo sapiens ]
• Official Symbol: APOC1
• Synonyms: APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1
• Gene ID: 341
• mRNA Refseq: NM_001645
• Protein Refseq: NP_001636
• MIM: 107710
• UniProt ID: P02654