Recombinant Human APOBEC3D protein, GST-tagged

• Cat.No.: APOBEC3D-699H
• Product Overview: Human APOBEC3D full-length ORF ( ENSP00000216099, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 73 kDa
• AA Sequence: MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D [ Homo sapiens ]
• Official Symbol: APOBEC3D
• Synonyms: APOBEC3D; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D; APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3D (putative) , apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3E pseudogene; probable DNA dC->dU-editing enzyme APOBEC-3D; ARP6; probable DNA dC-> dU-editing enzyme APOBEC-3D; DNA dC-> apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene; APOBEC3E; APOBEC3DE
• Gene ID: 140564
• mRNA Refseq: NM_152426
• Protein Refseq: NP_689639
• MIM: 609900
• UniProt ID: Q96AK3