Recombinant Human APOBEC1
Cat.No. : | APOBEC1-26872TH |
Product Overview : | Recombinant fragment of Human APOBEC1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed exclusively in the small intestine. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR |
Sequence Similarities : | Belongs to the cytidine and deoxycytidylate deaminase family. |
Gene Name | APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ] |
Official Symbol | APOBEC1 |
Synonyms | APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR; |
Gene ID | 339 |
mRNA Refseq | NM_001644 |
Protein Refseq | NP_001635 |
MIM | 600130 |
Uniprot ID | P41238 |
Chromosome Location | 12p13.1 |
Pathway | Formation of the Editosome, organism-specific biosystem; mRNA Editing, organism-specific biosystem; mRNA Editing: C to U Conversion, organism-specific biosystem; mRNA Processing, organism-specific biosystem; |
Function | AU-rich element binding; RNA binding; cytidine deaminase activity; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
APOBEC1-1785M | Recombinant Mouse APOBEC1 Protein | +Inquiry |
APOBEC1-631M | Recombinant Mouse APOBEC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC1-377R | Recombinant Rat APOBEC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC1-721R | Recombinant Rat APOBEC1 Protein | +Inquiry |
APOBEC1-695H | Recombinant Human APOBEC1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC1-8786HCL | Recombinant Human APOBEC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOBEC1 Products
Required fields are marked with *
My Review for All APOBEC1 Products
Required fields are marked with *
0
Inquiry Basket