Recombinant Human APOBEC1

• Cat.No.: APOBEC1-26872TH
• Product Overview: Recombinant fragment of Human APOBEC1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Description: This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed exclusively in the small intestine.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR
• Sequence Similarities: Belongs to the cytidine and deoxycytidylate deaminase family.
• Tag: Non

Gene Information

• Gene Name: APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ]
• Official Symbol: APOBEC1
• Synonyms: APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR
• Gene ID: 339
• mRNA Refseq: NM_001644
• Protein Refseq: NP_001635
• MIM: 600130
• Uniprot ID: P41238
• Chromosome Location: 12p13.1
• Pathway: Formation of the Editosome, organism-specific biosystem; mRNA Editing, organism-specific biosystem; mRNA Editing: C to U Conversion, organism-specific biosystem; mRNA Processing, organism-specific biosystem
• Function: AU-rich element binding; RNA binding; cytidine deaminase activity; hydrolase activity; metal ion binding