Recombinant Human APOB48R protein, GST-tagged
Cat.No. : | APOB48R-694H |
Product Overview : | Human APOB48R partial ORF ( NP_061160, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOBR apolipoprotein B receptor [ Homo sapiens ] |
Official Symbol | APOBR |
Synonyms | APOBR; apolipoprotein B receptor; APOB48R; APOB100R; apolipoprotein B48 receptor; apolipoprotein B100 receptor; apoB-48R; apolipoprotein B-48 receptor; apolipoprotein B-100 receptor; |
Gene ID | 55911 |
mRNA Refseq | NM_018690 |
Protein Refseq | NP_061160 |
MIM | 605220 |
UniProt ID | Q0VD83 |
◆ Recombinant Proteins | ||
APOBR-2486H | Recombinant Human APOBR Protein, His (Fc)-Avi-tagged | +Inquiry |
APOB48R-694H | Recombinant Human APOB48R protein, GST-tagged | +Inquiry |
APOBR-744H | Recombinant Human APOBR | +Inquiry |
APOBR-9751H | Recombinant Human APOBR, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOBR Products
Required fields are marked with *
My Review for All APOBR Products
Required fields are marked with *
0
Inquiry Basket