Recombinant Human APOB48R protein, GST-tagged

• Cat.No.: APOB48R-694H
• Product Overview: Human APOB48R partial ORF ( NP_061160, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBR apolipoprotein B receptor [ Homo sapiens ]
• Official Symbol: APOBR
• Synonyms: APOBR; apolipoprotein B receptor; APOB48R; APOB100R; apolipoprotein B48 receptor; apolipoprotein B100 receptor; apoB-48R; apolipoprotein B-48 receptor; apolipoprotein B-100 receptor
• Gene ID: 55911
• mRNA Refseq: NM_018690
• Protein Refseq: NP_061160
• MIM: 605220
• UniProt ID: Q0VD83