Recombinant Human APOA4, His-tagged
Cat.No. : | APOA4-30H |
Product Overview : | Recombinant Human Apolipoprotein A4/APOA4 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ser396) of Human APOA4 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-396 a.a. |
Description : | Apolipoprotein A4 (APOA4) is a secreted protein that belongs to the apolipoprotein A1/A4/E family. Apoa-IV is a major component of HDL and chylomicrons. APOA4 is secreted into circulation on the surface of newly synthesized chylomicron particles. APOA4 play a role in the regulation of appetite and satiety in rodent models. APOA4 involved in chylomicrons and VLDL secretion and catabolism and required for efficient activation of lipoprotein lipase by ApoC-II. In addition, APOA4 is a potent activator of lecithin-cholesterol acyltransferase in vitro. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFAT ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQA EQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEK DLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLESVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | APOA4 apolipoprotein A-IV [ Homo sapiens ] |
Official Symbol | APOA4 |
Synonyms | APOA4; apolipoprotein A-IV; apo-AIV; apoA-IV; apolipoprotein A4; MGC142154; MGC142156; |
Gene ID | 337 |
mRNA Refseq | NM_000482 |
Protein Refseq | NP_000473 |
MIM | 107690 |
UniProt ID | P06727 |
Chromosome Location | 11q23-qter |
Pathway | Amyloids, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; Disease, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; |
Function | antioxidant activity; cholesterol transporter activity; copper ion binding; contributes_to eukaryotic cell surface binding; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
APOA4-628M | Recombinant Mouse APOA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA4-4688H | Recombinant Human APOA4 protein, His-tagged | +Inquiry |
APOA4-719R | Recombinant Rat APOA4 Protein | +Inquiry |
APOA4-1718H | Recombinant Human APOA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
APOA4-3567P | Recombinant Pig APOA4, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA4-8788HCL | Recombinant Human APOA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOA4 Products
Required fields are marked with *
My Review for All APOA4 Products
Required fields are marked with *
0
Inquiry Basket