Recombinant Human APOA1 protein, GST-tagged
Cat.No. : | APOA1-689H |
Product Overview : | Human APOA1 full-length ORF ( AAH05380, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 55.11 kDa |
AA Sequence : | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOA1 apolipoprotein A-I [ Homo sapiens ] |
Official Symbol | APOA1 |
Synonyms | APOA1; apolipoprotein A-I; apo-AI; apoA-I; MGC117399; |
Gene ID | 335 |
mRNA Refseq | NM_000039 |
Protein Refseq | NP_000030 |
MIM | 107680 |
UniProt ID | P02647 |
◆ Recombinant Proteins | ||
ApoA1-8446R | Active Recombinant Rat ApoA1 | +Inquiry |
APOA1-2725P | Recombinant Pig APOA1 protein, His & GST-tagged | +Inquiry |
Apoa1-545M | Recombinant Mouse Apoa1 protein, His&Myc-tagged | +Inquiry |
APOA1-9747H | Recombinant Human APOA1, GST-tagged | +Inquiry |
APOA1-523H | Recombinant Human APOA1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-256H | Native Human APOA1 protein | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *
0
Inquiry Basket