Recombinant Human APLP1 Protein, His-tagged

• Cat.No.: APLP1-63H
• Product Overview: Recombinant Human Amyloid-like Protein 1 is produced by our Mammalian expression system and the target gene encoding Gly42-Pro212 is expressed with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: Gly42-Pro212
• Description: Amyloid-like protein 1 (APLP-1) is a member of the highly conserved amyloid precursor protein gene family. APLP1 is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. APLP1, together with APLP2, are important modulators of glucose. APLP1 may also play a role in synaptic maturation during cortical development, and is genetically linked to Alzheimer'sdisease.
• Form: Lyophilized from a 0.2 um filtered solution of PBS, 1mM EDTA, pH7.4.
• AA Sequence: GGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARV EQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRR HQEAQEACSSQGLILHGSGMLLPCGSDRFRGV EYVCCPPHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: APLP1 amyloid beta precursor like protein 1 [ Homo sapiens (human) ]
• Official Symbol: APLP1
• Synonyms: Amyloid-like protein 1; APLP; APLP-1; C30; APLP1
• Gene ID: 333
• mRNA Refseq: NM_005166.5
• Protein Refseq: NP_005157.1
• MIM: 104775
• UniProt ID: P51693