Recombinant Human APH1A Full Length Transmembrane protein (1-247 aa), His-SUMO-tagged

• Cat.No.: APH1A-2712H
• Product Overview: Recombinant Human APH1A Protein (1-247 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-247aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.9kDa
• AA Sequence: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: APH1A anterior pharynx defective 1 homolog A (C. elegans) [ Homo sapiens ]
• Official Symbol: APH1A
• Synonyms: APH1A; anterior pharynx defective 1 homolog A (C. elegans); gamma-secretase subunit APH-1A; APH 1A; CGI 78; aph-1alpha; presenilin-stabilization factor; APH-1; APH-1A; CGI-78; 6530402N02Rik
• Gene ID: 51107
• mRNA Refseq: NM_001077628
• Protein Refseq: NP_001071096
• MIM: 607629
• UniProt ID: Q96BI3