Recombinant Human APG5L protein, GST-tagged

• Cat.No.: APG5L-679H
• Product Overview: Human APG5L partial ORF ( AAH02699, 176 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG5 ATG5 autophagy related 5 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG5
• Synonyms: ATG5; ATG5 autophagy related 5 homolog (S. cerevisiae); APG5 (autophagy 5, S. cerevisiae) like , APG5 autophagy 5 like (S. cerevisiae) , APG5L; autophagy protein 5; APG5; ASP; hAPG5; apoptosis specific protein; apoptosis-specific protein; APG5L; APG5-LIKE
• Gene ID: 9474
• mRNA Refseq: NM_004849
• Protein Refseq: NP_004840
• MIM: 604261
• UniProt ID: Q9H1Y0