Recombinant Human APAF1 protein, GST-tagged
Cat.No. : | APAF1-665H |
Product Overview : | Human APAF1 partial ORF ( NP_037361, 1138 a.a. - 1237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ] |
Official Symbol | APAF1 |
Synonyms | APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4; APAF-1; DKFZp781B1145; |
Gene ID | 317 |
mRNA Refseq | NM_001160 |
Protein Refseq | NP_001151 |
MIM | 602233 |
UniProt ID | O14727 |
◆ Recombinant Proteins | ||
APAF1-0784H | Recombinant Human APAF1 Protein (M1-S97), His tagged | +Inquiry |
APAF1-362R | Recombinant Rat APAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APAF1-1754M | Recombinant Mouse APAF1 Protein | +Inquiry |
Apaf1-197R | Recombinant Rat Apaf1 Protein, His-tagged | +Inquiry |
APAF1-1442H | Recombinant Human APAF1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APAF1-89HCL | Recombinant Human APAF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APAF1 Products
Required fields are marked with *
My Review for All APAF1 Products
Required fields are marked with *
0
Inquiry Basket