Recombinant Human APAF1 protein, GST-tagged

Cat.No. : APAF1-665H
Product Overview : Human APAF1 partial ORF ( NP_037361, 1138 a.a. - 1237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.85 kDa
AA Sequence : GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ]
Official Symbol APAF1
Synonyms APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4; APAF-1; DKFZp781B1145;
Gene ID 317
mRNA Refseq NM_001160
Protein Refseq NP_001151
MIM 602233
UniProt ID O14727

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APAF1 Products

Required fields are marked with *

My Review for All APAF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon