Recombinant Human APAF1

Cat.No. : APAF1-27358TH
Product Overview : Recombinant fragment corresponding to amino acids 1138-1237 Human APAF1, with a proprietary tag; predicted MWt 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Sequence Similarities : Contains 1 CARD domain.Contains 1 NB-ARC domain.Contains 13 WD repeats.
Gene Name APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ]
Official Symbol APAF1
Synonyms APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4;
Gene ID 317
mRNA Refseq NM_001160
Protein Refseq NP_001151
MIM 602233
Uniprot ID O14727
Chromosome Location 12q23
Pathway Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function ADP binding; ATP binding; cysteine-type endopeptidase activator activity involved in apoptotic process; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APAF1 Products

Required fields are marked with *

My Review for All APAF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon