Recombinant Human AP4E1 protein, GST-tagged

• Cat.No.: AP4E1-662H
• Product Overview: Human AP4E1 partial ORF ( NP_031373, 1038 a.a. - 1137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the adaptor complexes large subunit protein family. These proteins are components of the heterotetrameric adaptor protein complexes, which play important roles in the secretory and endocytic pathways by mediating vesicle formation and sorting of integral membrane proteins. The encoded protein is a large subunit of adaptor protein complex-4, which is associated with both clathrin- and nonclathrin-coated vesicles. Disruption of this gene may be associated with cerebral palsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: SDDFGKLWLSFANDVKQNVKMSESQAALPSALKTLQQKLRLHIIEIIGNEGLLACQLLPSIPCLLHCRVHADVLALWFRSSCSTLPDYLLYQCQKVMEGS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP4E1 adaptor related protein complex 4 epsilon 1 subunit [ Homo sapiens (human) ]
• Official Symbol: AP4E1
• Synonyms: AP4E1; adaptor related protein complex 4 epsilon 1 subunit; CPSQ4; SPG51; STUT1; AP-4 complex subunit epsilon-1; AP-4 adaptor complex subunit epsilon; adaptor-related protein complex 4 subunit epsilon-1; adaptor-related protein complex AP-4 epsilon; epsilon-adaptin
• Gene ID: 23431
• mRNA Refseq: NM_001252127
• Protein Refseq: NP_001239056
• MIM: 607244
• UniProt ID: Q9UPM8