Recombinant Human AP3M2 protein, GST-tagged

• Cat.No.: AP3M2-658H
• Product Overview: Human AP3M2 full-length ORF ( NP_006794.1, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 73.4 kDa
• AA Sequence: MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP3M2 adaptor-related protein complex 3, mu 2 subunit [ Homo sapiens ]
• Official Symbol: AP3M2
• Synonyms: AP3M2; adaptor-related protein complex 3, mu 2 subunit; AP-3 complex subunit mu-2; AP47B; CLA20; mu3B-adaptin; HA1 47kDA subunit homolog 2; HA1 47 kDa subunit homolog 2; clathrin-associated protein AP47 homolog 2; golgi adaptor AP-1 47 kDA protein homolog 2; clathrin coat assembly protein AP47 homolog 2; adapter-related protein complex 3 mu-2 subunit; clathrin coat-associated protein AP47 homolog 2; clathrin assembly protein assembly protein complex 1 medium chain homolog 2; P47B
• Gene ID: 10947
• mRNA Refseq: NM_001134296
• Protein Refseq: NP_001127768
• MIM: 610469
• UniProt ID: P53677