Recombinant Human AP3M2 protein, GST-tagged
Cat.No. : | AP3M2-658H |
Product Overview : | Human AP3M2 full-length ORF ( NP_006794.1, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 73.4 kDa |
AA Sequence : | MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP3M2 adaptor-related protein complex 3, mu 2 subunit [ Homo sapiens ] |
Official Symbol | AP3M2 |
Synonyms | AP3M2; adaptor-related protein complex 3, mu 2 subunit; AP-3 complex subunit mu-2; AP47B; CLA20; mu3B-adaptin; HA1 47kDA subunit homolog 2; HA1 47 kDa subunit homolog 2; clathrin-associated protein AP47 homolog 2; golgi adaptor AP-1 47 kDA protein homolog 2; clathrin coat assembly protein AP47 homolog 2; adapter-related protein complex 3 mu-2 subunit; clathrin coat-associated protein AP47 homolog 2; clathrin assembly protein assembly protein complex 1 medium chain homolog 2; P47B; |
Gene ID | 10947 |
mRNA Refseq | NM_001134296 |
Protein Refseq | NP_001127768 |
MIM | 610469 |
UniProt ID | P53677 |
◆ Recombinant Proteins | ||
AP3M2-658H | Recombinant Human AP3M2 protein, GST-tagged | +Inquiry |
AP3M2-359R | Recombinant Rat AP3M2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP3M2-607M | Recombinant Mouse AP3M2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP3M2-3542H | Recombinant Human AP3M2, His-tagged | +Inquiry |
AP3M2-1159HF | Recombinant Full Length Human AP3M2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP3M2-87HCL | Recombinant Human AP3M2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AP3M2 Products
Required fields are marked with *
My Review for All AP3M2 Products
Required fields are marked with *
0
Inquiry Basket