Recombinant Human AP3B1 protein, GST-tagged

• Cat.No.: AP3B1-655H
• Product Overview: Human AP3B1 partial ORF ( NP_003655, 995 a.a. - 1094 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2012]
• Molecular Mass: 36.74 kDa
• AA Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP3B1 adaptor-related protein complex 3, beta 1 subunit [ Homo sapiens ]
• Official Symbol: AP3B1
• Synonyms: AP3B1; adaptor-related protein complex 3, beta 1 subunit; AP-3 complex subunit beta-1; ADTB3A; HPS2; beta3A-adaptin; beta-3A-adaptin; AP-3 complex beta-3A subunit; adaptor protein complex AP-3 subunit beta-1; adapter-related protein complex 3 subunit beta-1; clathrin assembly protein complex 3 beta-1 large chain; PE; HPS; ADTB3
• Gene ID: 8546
• mRNA Refseq: NM_003664
• Protein Refseq: NP_003655
• MIM: 603401
• UniProt ID: O00203