Recombinant Human AP3B1 protein, GST-tagged
Cat.No. : | AP3B1-655H |
Product Overview : | Human AP3B1 partial ORF ( NP_003655, 995 a.a. - 1094 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP3B1 adaptor-related protein complex 3, beta 1 subunit [ Homo sapiens ] |
Official Symbol | AP3B1 |
Synonyms | AP3B1; adaptor-related protein complex 3, beta 1 subunit; AP-3 complex subunit beta-1; ADTB3A; HPS2; beta3A-adaptin; beta-3A-adaptin; AP-3 complex beta-3A subunit; adaptor protein complex AP-3 subunit beta-1; adapter-related protein complex 3 subunit beta-1; clathrin assembly protein complex 3 beta-1 large chain; PE; HPS; ADTB3; |
Gene ID | 8546 |
mRNA Refseq | NM_003664 |
Protein Refseq | NP_003655 |
MIM | 603401 |
UniProt ID | O00203 |
◆ Recombinant Proteins | ||
AP3B1-655H | Recombinant Human AP3B1 protein, GST-tagged | +Inquiry |
AP3B1-3538H | Recombinant Human AP3B1, His-tagged | +Inquiry |
AP3B1-9719H | Recombinant Human AP3B1, GST-tagged | +Inquiry |
AP3B1-188H | Recombinant Human AP3B1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP3B1-8810HCL | Recombinant Human AP3B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AP3B1 Products
Required fields are marked with *
My Review for All AP3B1 Products
Required fields are marked with *
0
Inquiry Basket