Recombinant Human AP1S3 Protein (1-104 aa), GST-tagged

• Cat.No.: AP1S3-330H
• Product Overview: Recombinant Human AP1S3 Protein (1-104 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 3.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-104 aa
• Description: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.7 kDa
• AA Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: AP1S3 adaptor related protein complex 1 subunit sigma 3 [ Homo sapiens (human) ]
• Official Symbol: AP1S3
• Synonyms: PSORS15
• Gene ID: 130340
• mRNA Refseq: NM_001039569
• Protein Refseq: NP_001034658
• UniProt ID: Q96PC3