Recombinant Human AP1S2 protein, GST-tagged

Cat.No. : AP1S2-650H
Product Overview : Human AP1S2 full-length ORF ( AAH01117, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
Molecular Mass : 43.01 kDa
AA Sequence : MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP1S2 adaptor-related protein complex 1, sigma 2 subunit [ Homo sapiens ]
Official Symbol AP1S2
Synonyms AP1S2; adaptor-related protein complex 1, sigma 2 subunit; mental retardation, X linked 59 , MRX59; AP-1 complex subunit sigma-2; SIGMA1B; sigma1B-adaptin; sigma-adaptin 1B; sigma 1B subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1B subunit; clathrin adaptor complex AP1 sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma-1B subunit; adapter-related protein complex 1 sigma-1B subunit; clathrin assembly protein complex 1 sigma-1B small chain; DC22; MRX59; MRXSF; MRXS21; MGC:1902;
Gene ID 8905
mRNA Refseq NM_003916
Protein Refseq NP_003907
MIM 300629
UniProt ID P56377

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AP1S2 Products

Required fields are marked with *

My Review for All AP1S2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon