Recombinant Human AP1S2 protein, GST-tagged
Cat.No. : | AP1S2-650H |
Product Overview : | Human AP1S2 full-length ORF ( AAH01117, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013] |
Molecular Mass : | 43.01 kDa |
AA Sequence : | MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP1S2 adaptor-related protein complex 1, sigma 2 subunit [ Homo sapiens ] |
Official Symbol | AP1S2 |
Synonyms | AP1S2; adaptor-related protein complex 1, sigma 2 subunit; mental retardation, X linked 59 , MRX59; AP-1 complex subunit sigma-2; SIGMA1B; sigma1B-adaptin; sigma-adaptin 1B; sigma 1B subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1B subunit; clathrin adaptor complex AP1 sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma-1B subunit; adapter-related protein complex 1 sigma-1B subunit; clathrin assembly protein complex 1 sigma-1B small chain; DC22; MRX59; MRXSF; MRXS21; MGC:1902; |
Gene ID | 8905 |
mRNA Refseq | NM_003916 |
Protein Refseq | NP_003907 |
MIM | 300629 |
UniProt ID | P56377 |
◆ Recombinant Proteins | ||
AP1S2-1073HF | Recombinant Full Length Human AP1S2 Protein, GST-tagged | +Inquiry |
AP1S2-1408C | Recombinant Chicken AP1S2 | +Inquiry |
AP1S2-650H | Recombinant Human AP1S2 protein, GST-tagged | +Inquiry |
AP1S2-11602Z | Recombinant Zebrafish AP1S2 | +Inquiry |
AP1S2-3546H | Recombinant Human AP1S2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AP1S2 Products
Required fields are marked with *
My Review for All AP1S2 Products
Required fields are marked with *
0
Inquiry Basket