Recombinant Human AP1M2 protein, GST-tagged

• Cat.No.: AP1M2-648H
• Product Overview: Human AP1M2 full-length ORF ( NP_005489.2, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 74.5 kDa
• AA Sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP1M2 adaptor-related protein complex 1, mu 2 subunit [ Homo sapiens ]
• Official Symbol: AP1M2
• Synonyms: AP1M2; adaptor-related protein complex 1, mu 2 subunit; AP-1 complex subunit mu-2; AP1 mu2; HSMU1B; mu2; mu-adaptin 2; mu1B-adaptin; HA1 47 kDa subunit 2; AP-mu chain family member mu1B; golgi adaptor AP-1 47 kDa protein; clathrin coat assembly protein AP47 2; clathrin coat associated protein AP47 2; adaptor protein complex AP-1 mu-2 subunit; golgi adaptor HA1/AP1 adaptin mu-2 subunit; clathrin-associated adaptor medium chain mu2; adaptor-related protein complex 1 mu-2 subunit; clathrin assembly protein complex 1 medium chain 2; MU1B; MU-1B; AP1-mu2
• Gene ID: 10053
• mRNA Refseq: NM_005498
• Protein Refseq: NP_005489
• MIM: 607309
• UniProt ID: Q9Y6Q5