Recombinant Human AP1GBP1 protein, GST-tagged

• Cat.No.: AP1GBP1-646H
• Product Overview: Human AP1GBP1 partial ORF ( NP_009178.3, 456 a.a. - 555 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: DDFQDFQDASKSGSLDDSFSDFQELPASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYSAFRELEQTAENKPLG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SYNRG synergin, gamma [ Homo sapiens ]
• Official Symbol: SYNRG
• Synonyms: SYNG; AP1GBP1
• Gene ID: 11276
• mRNA Refseq: NM_198882.1
• Protein Refseq: NP_942583.1
• MIM: 607291
• UniProt ID: Q9UMZ2