Recombinant Human AP1GBP1 protein, GST-tagged

Cat.No. : AP1GBP1-646H
Product Overview : Human AP1GBP1 partial ORF ( NP_009178.3, 456 a.a. - 555 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : DDFQDFQDASKSGSLDDSFSDFQELPASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYSAFRELEQTAENKPLG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SYNRG synergin, gamma [ Homo sapiens ]
Official Symbol SYNRG
Synonyms SYNG; AP1GBP1
Gene ID 11276
mRNA Refseq NM_198882.1
Protein Refseq NP_942583.1
MIM 607291
UniProt ID Q9UMZ2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SYNRG Products

Required fields are marked with *

My Review for All SYNRG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon