Recombinant Human ANXA8L2 protein, GST-tagged
Cat.No. : | ANXA8L2-4531H |
Product Overview : | Recombinant Human ANXA8L2 protein(Q5VT79)(1-276aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-276aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ANXA8L2 annexin A8-like 2 [ Homo sapiens ] |
Official Symbol | ANXA8L2 |
Synonyms | ANXA8L2; annexin A8-like 2; annexin A8-like protein 2; bA145E20.2; annexin A8L2; ANXA8; FLJ32754; FLJ39396; FLJ54151; KIAA0187; |
Gene ID | 244 |
mRNA Refseq | NM_001630 |
Protein Refseq | NP_001621 |
UniProt ID | Q5VT79 |
◆ Recombinant Proteins | ||
ANXA8L2-9701H | Recombinant Human ANXA8L2, GST-tagged | +Inquiry |
ANXA8L2-6845H | Recombinant Human Annexin A8-Like 2, His-tagged | +Inquiry |
ANXA8L2-4531H | Recombinant Human ANXA8L2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA8L2-28HCL | Recombinant Human ANXA8L2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA8L2 Products
Required fields are marked with *
My Review for All ANXA8L2 Products
Required fields are marked with *
0
Inquiry Basket