Recombinant Human ANXA8L2 protein, GST-tagged

Cat.No. : ANXA8L2-4531H
Product Overview : Recombinant Human ANXA8L2 protein(Q5VT79)(1-276aa), fused to N-terminal GST tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-276aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 57.7 kDa
AA Sequence : MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ANXA8L2 annexin A8-like 2 [ Homo sapiens ]
Official Symbol ANXA8L2
Synonyms ANXA8L2; annexin A8-like 2; annexin A8-like protein 2; bA145E20.2; annexin A8L2; ANXA8; FLJ32754; FLJ39396; FLJ54151; KIAA0187;
Gene ID 244
mRNA Refseq NM_001630
Protein Refseq NP_001621
UniProt ID Q5VT79

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANXA8L2 Products

Required fields are marked with *

My Review for All ANXA8L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon