Recombinant Human ANXA8L2 protein, GST-tagged

• Cat.No.: ANXA8L2-4531H
• Product Overview: Recombinant Human ANXA8L2 protein(Q5VT79)(1-276aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.7 kDa
• Protein length: 1-276aa
• AA Sequence: MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ANXA8L2 annexin A8-like 2 [ Homo sapiens ]
• Official Symbol: ANXA8L2
• Synonyms: ANXA8L2; annexin A8-like 2; annexin A8-like protein 2; bA145E20.2; annexin A8L2; ANXA8; FLJ32754; FLJ39396; FLJ54151; KIAA0187
• Gene ID: 244
• mRNA Refseq: NM_001630
• Protein Refseq: NP_001621
• UniProt ID: Q5VT79