Recombinant Human ANXA5 Protein, His-tagged
Cat.No. : | ANXA5-1124H |
Product Overview : | Recombinant Human ANXA5 Protein (2-320aa) was expressed in yeast with N-terminal 6His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-320 a.a. |
Description : | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
Official Symbol | ANXA5 |
Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2 |
Gene ID | 308 |
mRNA Refseq | NM_001154 |
Protein Refseq | NP_001145 |
MIM | 131230 |
UniProt ID | P08758 |
◆ Recombinant Proteins | ||
ANXA5-4705H | Recombinant Human ANXA5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANXA5-635H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
ANXA5-691R | Recombinant Rat ANXA5 Protein | +Inquiry |
ANXA5-6912H | Recombinant Human ANXA5 protein | +Inquiry |
ANXA5-454H | Recombinant Human ANXA5 protein, His-tagged, Animal-Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket