Recombinant Human ANXA5 protein, GST-tagged

• Cat.No.: ANXA5-635H
• Product Overview: Human ANXA5 full-length ORF ( AAH01429, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]
• Molecular Mass: 60.94 kDa
• AA Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANXA5 annexin A5 [ Homo sapiens ]
• Official Symbol: ANXA5
• Synonyms: ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2
• Gene ID: 308
• mRNA Refseq: NM_001154
• Protein Refseq: NP_001145
• MIM: 131230
• UniProt ID: P08758