Recombinant Human ANXA4 protein, His-SUMO & Myc-tagged

• Cat.No.: ANXA4-2519H
• Product Overview: Recombinant Human ANXA4 protein(P09525)(2-319aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 55.8 kDa
• Protein length: 2-319aa
• AA Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ANXA4 annexin A4 [ Homo sapiens ]
• Official Symbol: ANXA4
• Synonyms: ANXA4; annexin A4; ANX4; P32.5; PP4-X; PAP-II; annexin-4; protein II; endonexin I; lipocortin IV; chromobindin-4; 35-beta calcimedin; proliferation-inducing gene 28; proliferation-inducing protein 28; placental anticoagulant protein II; carbohydrate-binding protein p33/p41; annexin IV (placental anticoagulant protein II); PIG28; ZAP36; MGC75105; DKFZp686H02120
• Gene ID: 307
• mRNA Refseq: NM_001153
• Protein Refseq: NP_001144
• MIM: 106491
• UniProt ID: P09525