Recombinant Human ANXA4 protein, His-SUMO & Myc-tagged
Cat.No. : | ANXA4-2519H |
Product Overview : | Recombinant Human ANXA4 protein(P09525)(2-319aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 2-319aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.8 kDa |
AA Sequence : | ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ANXA4 annexin A4 [ Homo sapiens ] |
Official Symbol | ANXA4 |
Synonyms | ANXA4; annexin A4; ANX4; P32.5; PP4-X; PAP-II; annexin-4; protein II; endonexin I; lipocortin IV; chromobindin-4; 35-beta calcimedin; proliferation-inducing gene 28; proliferation-inducing protein 28; placental anticoagulant protein II; carbohydrate-binding protein p33/p41; annexin IV (placental anticoagulant protein II); PIG28; ZAP36; MGC75105; DKFZp686H02120; |
Gene ID | 307 |
mRNA Refseq | NM_001153 |
Protein Refseq | NP_001144 |
MIM | 106491 |
UniProt ID | P09525 |
◆ Recombinant Proteins | ||
ANXA4-634H | Recombinant Human ANXA4 protein, GST-tagged | +Inquiry |
ANXA4-2519H | Recombinant Human ANXA4 protein, His-SUMO & Myc-tagged | +Inquiry |
ANXA4-18H | Recombinant Human ANXA4 protein, His-tagged | +Inquiry |
ANXA4-1842 | Recombinant Human Annexin A4 | +Inquiry |
ANXA4-9640Z | Recombinant Zebrafish ANXA4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA4-8831HCL | Recombinant Human ANXA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA4 Products
Required fields are marked with *
My Review for All ANXA4 Products
Required fields are marked with *
0
Inquiry Basket