Recombinant Human ANP32A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ANP32A-5466H
• Product Overview: ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ANP32A (Acidic Nuclear Phosphoprotein 32 Family Member A) is a Protein Coding gene. Diseases associated with ANP32A include Spinocerebellar Ataxia 1 and Primary Cerebellar Degeneration. Among its related pathways are Granzyme-A Pathway and Granzyme Pathway. An important paralog of this gene is ANP32B.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 28.6 kDa
• AA Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ANP32A acidic nuclear phosphoprotein 32 family member A [ Homo sapiens (human) ]
• Official Symbol: ANP32A
• Synonyms: ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; hepatopoietin Cn; acidic nuclear phosphoprotein pp32; leucine-rich acidic nuclear protein; putative HLA-DR-associated protein I; inhibitor-1 of protein phosphatase-2A; cerebellar leucine rich acidic nuclear protein; putative human HLA class II associated protein I; potent heat-stable protein phosphatase 2A inhibitor I1PP2A; HPPCn; PHAP1; MGC119787; MGC150373
• Gene ID: 8125
• mRNA Refseq: NM_006305
• Protein Refseq: NP_006296
• MIM: 600832
• UniProt ID: P39687