Recombinant Human ANP32A protein, GST-tagged
Cat.No. : | ANP32A-617H |
Product Overview : | Human ANP32A full-length ORF ( AAH07200, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANP32A (Acidic Nuclear Phosphoprotein 32 Family Member A) is a Protein Coding gene. Diseases associated with ANP32A include Spinocerebellar Ataxia 1. Among its related pathways are Apoptosis induced DNA fragmentation and DNA Damage. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is ANP32B. |
Molecular Mass : | 53.13 kDa |
AA Sequence : | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ] |
Official Symbol | ANP32A |
Synonyms | ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; hepatopoietin Cn; acidic nuclear phosphoprotein pp32; leucine-rich acidic nuclear protein; putative HLA-DR-associated protein I; inhibitor-1 of protein phosphatase-2A; cerebellar leucine rich acidic nuclear protein; putative human HLA class II associated protein I; potent heat-stable protein phosphatase 2A inhibitor I1PP2A; HPPCn; PHAP1; MGC119787; MGC150373; |
Gene ID | 8125 |
mRNA Refseq | NM_006305 |
Protein Refseq | NP_006296 |
MIM | 600832 |
UniProt ID | P39687 |
◆ Recombinant Proteins | ||
ANP32A-0173H | Recombinant Human ANP32A Protein (Glu2-Asp175), N-His-tagged | +Inquiry |
ANP32A-617H | Recombinant Human ANP32A protein, GST-tagged | +Inquiry |
Anp32a-3074M | Recombinant Mouse Anp32a, His-tagged | +Inquiry |
ANP32A-339R | Recombinant Rat ANP32A Protein, His (Fc)-Avi-tagged | +Inquiry |
Anp32a-604M | Recombinant Mouse Anp32a Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANP32A-8843HCL | Recombinant Human ANP32A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANP32A Products
Required fields are marked with *
My Review for All ANP32A Products
Required fields are marked with *
0
Inquiry Basket