Recombinant Human ANP32A protein, GST-tagged

• Cat.No.: ANP32A-617H
• Product Overview: Human ANP32A full-length ORF ( AAH07200, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANP32A (Acidic Nuclear Phosphoprotein 32 Family Member A) is a Protein Coding gene. Diseases associated with ANP32A include Spinocerebellar Ataxia 1. Among its related pathways are Apoptosis induced DNA fragmentation and DNA Damage. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is ANP32B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.13 kDa
• AA Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ]
• Official Symbol: ANP32A
• Synonyms: ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; hepatopoietin Cn; acidic nuclear phosphoprotein pp32; leucine-rich acidic nuclear protein; putative HLA-DR-associated protein I; inhibitor-1 of protein phosphatase-2A; cerebellar leucine rich acidic nuclear protein; putative human HLA class II associated protein I; potent heat-stable protein phosphatase 2A inhibitor I1PP2A; HPPCn; PHAP1; MGC119787; MGC150373
• Gene ID: 8125
• mRNA Refseq: NM_006305
• Protein Refseq: NP_006296
• MIM: 600832
• UniProt ID: P39687