Recombinant Human ANLN protein, GST-tagged

• Cat.No.: ANLN-616H
• Product Overview: Human ANLN full-length ORF ( AAH34692, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an actin-binding protein that plays a role in cell growth and migration, and in cytokinesis. The encoded protein is thought to regulate actin cytoskeletal dynamics in podocytes, components of the glomerulus. Mutations in this gene are associated with focal segmental glomerulosclerosis 8. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 70.29 kDa
• AA Sequence: MQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKRTLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFRARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANLN anillin, actin binding protein [ Homo sapiens ]
• Official Symbol: ANLN
• Synonyms: ANLN; anillin, actin binding protein; anillin (Drosophila Scraps homolog), actin binding protein , anillin, actin binding protein (scraps homolog, Drosophila); actin-binding protein anillin; ANILLIN; scra; Scraps; DKFZp779A055
• Gene ID: 54443
• mRNA Refseq: NM_018685
• Protein Refseq: NP_061155
• UniProt ID: Q9NQW6