Recombinant Human ANKS1B protein, His-tagged

Cat.No. : ANKS1B-3767H
Product Overview : Recombinant Human ANKS1B protein(446-510 aa), fused to His tag, was expressed in E. coli.
Availability March 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 446-510 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ANKS1B ankyrin repeat and sterile alpha motif domain containing 1B [ Homo sapiens ]
Official Symbol ANKS1B
Synonyms ANKS1B; ankyrin repeat and sterile alpha motif domain containing 1B; ankyrin repeat and sterile alpha motif domain-containing protein 1B; AIDA 1; ANKS2; cajalin 2; EB 1; E2a-Pbx1-associated protein; amyloid-beta precursor protein intracellular domain associated protein 1; EB1; AIDA; EB-1; AIDA-1; cajalin-2; MGC26087;
Gene ID 56899
mRNA Refseq NM_001204065
Protein Refseq NP_001190994
MIM 607815
UniProt ID Q7Z6G8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANKS1B Products

Required fields are marked with *

My Review for All ANKS1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon