Recombinant Human ANKS1B protein, His-tagged

• Cat.No.: ANKS1B-3767H
• Product Overview: Recombinant Human ANKS1B protein(446-510 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 446-510 aa
• AA Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ANKS1B ankyrin repeat and sterile alpha motif domain containing 1B [ Homo sapiens ]
• Official Symbol: ANKS1B
• Synonyms: ANKS1B; ankyrin repeat and sterile alpha motif domain containing 1B; ankyrin repeat and sterile alpha motif domain-containing protein 1B; AIDA 1; ANKS2; cajalin 2; EB 1; E2a-Pbx1-associated protein; amyloid-beta precursor protein intracellular domain associated protein 1; EB1; AIDA; EB-1; AIDA-1; cajalin-2; MGC26087
• Gene ID: 56899
• mRNA Refseq: NM_001204065
• Protein Refseq: NP_001190994
• MIM: 607815
• UniProt ID: Q7Z6G8