Recombinant Human ANKS1 protein, GST-tagged

• Cat.No.: ANKS1-610H
• Product Overview: Human ANKS1 partial ORF ( NP_056060, 1037 a.a. - 1132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKS1A (Ankyrin Repeat And Sterile Alpha Motif Domain Containing 1A) is a Protein Coding gene. Diseases associated with ANKS1A include Adjustment Disorder. An important paralog of this gene is ANKS1B.
• Molecular Mass: 36.3 kDa
• AA Sequence: HVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAEMIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKS1A ankyrin repeat and sterile alpha motif domain containing 1A [ Homo sapiens ]
• Official Symbol: ANKS1A
• Synonyms: ANKS1A; ankyrin repeat and sterile alpha motif domain containing 1A; ANKS1, ankyrin repeat and SAM domain containing 1 , ankyrin repeat and sterile alpha motif domain containing 1; ankyrin repeat and SAM domain-containing protein 1A; KIAA0229; Odin; ankyrin repeat and SAM domain containing 1; ANKS1; MGC42354
• Gene ID: 23294
• mRNA Refseq: NM_015245
• Protein Refseq: NP_056060
• MIM: 608994
• UniProt ID: Q92625