Recombinant Human ANKRD65 Protein, GST-tagged
Cat.No. : | ANKRD65-4624H |
Product Overview : | Human hCG_20426 full-length ORF ( ACE87293.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | ANKRD65 (Ankyrin Repeat Domain 65) is a Protein Coding gene. An important paralog of this gene is ANKRD17. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 45.54 kDa |
AA Sequence : | MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEETTLRCCWATGQTQASGTGMAALRCTGLPPEDTCLPSSCWSPRGPRWMRGTPWASHPCITPLGKATWRLPAACWTGVPRWMLPAGSERPPYTWLQSEGMGLPWGFC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD65 ankyrin repeat domain 65 [ Homo sapiens (human) ] |
Official Symbol | ANKRD65 |
Synonyms | ANKRD65; ankyrin repeat domain 65; ankyrin repeat domain-containing protein 65; |
Gene ID | 441869 |
mRNA Refseq | NM_001145210 |
Protein Refseq | NP_001138682 |
UniProt ID | E5RJM6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ANKRD65 Products
Required fields are marked with *
My Review for All ANKRD65 Products
Required fields are marked with *
0
Inquiry Basket