Recombinant Human ANKRD65 Protein, GST-tagged

• Cat.No.: ANKRD65-4624H
• Product Overview: Human hCG_20426 full-length ORF ( ACE87293.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANKRD65 (Ankyrin Repeat Domain 65) is a Protein Coding gene. An important paralog of this gene is ANKRD17.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.54 kDa
• AA Sequence: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEETTLRCCWATGQTQASGTGMAALRCTGLPPEDTCLPSSCWSPRGPRWMRGTPWASHPCITPLGKATWRLPAACWTGVPRWMLPAGSERPPYTWLQSEGMGLPWGFC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD65 ankyrin repeat domain 65 [ Homo sapiens (human) ]
• Official Symbol: ANKRD65
• Synonyms: ANKRD65; ankyrin repeat domain 65; ankyrin repeat domain-containing protein 65
• Gene ID: 441869
• mRNA Refseq: NM_001145210
• Protein Refseq: NP_001138682
• UniProt ID: E5RJM6