Recombinant Human ANKRD45 protein, GST-tagged

• Cat.No.: ANKRD45-600H
• Product Overview: Human ANKRD45 full-length ORF ( NP_940895.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD45 (Ankyrin Repeat Domain 45) is a Protein Coding gene.
• Molecular Mass: 56.4 kDa
• AA Sequence: MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD45 ankyrin repeat domain 45 [ Homo sapiens ]
• Official Symbol: ANKRD45
• Synonyms: ANKRD45; ankyrin repeat domain 45; ankyrin repeat domain-containing protein 45; cancer/testis antigen 117; CT117; FLJ45235; RP3-436N22.4; MGC161631; MGC161633
• Gene ID: 339416
• mRNA Refseq: NM_198493
• Protein Refseq: NP_940895
• UniProt ID: Q5TZF3