Recombinant Human ANKRD45 protein, GST-tagged
Cat.No. : | ANKRD45-600H |
Product Overview : | Human ANKRD45 full-length ORF ( NP_940895.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD45 (Ankyrin Repeat Domain 45) is a Protein Coding gene. |
Molecular Mass : | 56.4 kDa |
AA Sequence : | MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD45 ankyrin repeat domain 45 [ Homo sapiens ] |
Official Symbol | ANKRD45 |
Synonyms | ANKRD45; ankyrin repeat domain 45; ankyrin repeat domain-containing protein 45; cancer/testis antigen 117; CT117; FLJ45235; RP3-436N22.4; MGC161631; MGC161633; |
Gene ID | 339416 |
mRNA Refseq | NM_198493 |
Protein Refseq | NP_940895 |
UniProt ID | Q5TZF3 |
◆ Recombinant Proteins | ||
ANKRD45-2910Z | Recombinant Zebrafish ANKRD45 | +Inquiry |
Ankrd45-1637M | Recombinant Mouse Ankrd45 Protein, Myc/DDK-tagged | +Inquiry |
ANKRD45-600H | Recombinant Human ANKRD45 protein, GST-tagged | +Inquiry |
ANKRD45-1450HF | Recombinant Full Length Human ANKRD45 Protein, GST-tagged | +Inquiry |
ANKRD45-1280H | Recombinant Human ANKRD45 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD45-8849HCL | Recombinant Human ANKRD45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD45 Products
Required fields are marked with *
My Review for All ANKRD45 Products
Required fields are marked with *
0
Inquiry Basket