Recombinant Human ANKRD36B protein, GST-tagged

Cat.No. : ANKRD36B-593H
Product Overview : Human ANKRD36B full-length ORF ( AAH71771.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD36B (Ankyrin Repeat Domain 36B) is a Protein Coding gene. An important paralog of this gene is ANKRD36C.
Molecular Mass : 53.7 kDa
AA Sequence : MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNAIDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVVSSETTS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD36B ankyrin repeat domain 36B [ Homo sapiens (human) ]
Official Symbol ANKRD36B
Synonyms ANKRD36B; ankyrin repeat domain 36B; KIAA1641; ankyrin repeat domain-containing protein 36B; CLL-associated antigen KW-1; melanoma-associated antigen
Gene ID 57730
mRNA Refseq NM_025190
Protein Refseq NP_079466
UniProt ID Q8N2N9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANKRD36B Products

Required fields are marked with *

My Review for All ANKRD36B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon