Recombinant Human ANKRD36B protein, GST-tagged
Cat.No. : | ANKRD36B-593H |
Product Overview : | Human ANKRD36B full-length ORF ( AAH71771.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD36B (Ankyrin Repeat Domain 36B) is a Protein Coding gene. An important paralog of this gene is ANKRD36C. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNAIDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVVSSETTS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD36B ankyrin repeat domain 36B [ Homo sapiens (human) ] |
Official Symbol | ANKRD36B |
Synonyms | ANKRD36B; ankyrin repeat domain 36B; KIAA1641; ankyrin repeat domain-containing protein 36B; CLL-associated antigen KW-1; melanoma-associated antigen |
Gene ID | 57730 |
mRNA Refseq | NM_025190 |
Protein Refseq | NP_079466 |
UniProt ID | Q8N2N9 |
◆ Recombinant Proteins | ||
ANKRD36B-1258HF | Recombinant Full Length Human ANKRD36B Protein, GST-tagged | +Inquiry |
ANKRD36B-593H | Recombinant Human ANKRD36B protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD36B Products
Required fields are marked with *
My Review for All ANKRD36B Products
Required fields are marked with *
0
Inquiry Basket