Recombinant Human ANKRD36B protein, GST-tagged

• Cat.No.: ANKRD36B-593H
• Product Overview: Human ANKRD36B full-length ORF ( AAH71771.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANKRD36B (Ankyrin Repeat Domain 36B) is a Protein Coding gene. An important paralog of this gene is ANKRD36C.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.7 kDa
• AA Sequence: MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNAIDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVVSSETTS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD36B ankyrin repeat domain 36B [ Homo sapiens (human) ]
• Official Symbol: ANKRD36B
• Synonyms: ANKRD36B; ankyrin repeat domain 36B; KIAA1641; ankyrin repeat domain-containing protein 36B; CLL-associated antigen KW-1; melanoma-associated antigen
• Gene ID: 57730
• mRNA Refseq: NM_025190
• Protein Refseq: NP_079466
• UniProt ID: Q8N2N9