Recombinant Human ANKRD36 protein, GST-tagged

Cat.No. : ANKRD36-592H
Product Overview : Human ANKRD36 full-length ORF ( NP_940957.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD36 (Ankyrin Repeat Domain 36) is a Protein Coding gene. An important paralog of this gene is ANKRD36C.
Molecular Mass : 45.3 kDa
AA Sequence : MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD36 ankyrin repeat domain 36 [ Homo sapiens (human) ]
Official Symbol ANKRD36
Synonyms ANKRD36; ankyrin repeat domain 36; UNQ2430; ankyrin repeat domain-containing protein 36A; ankyrin repeat domain-containing protein 36; ankyrin-related
Gene ID 375248
mRNA Refseq NM_001164315
Protein Refseq NP_001157787
UniProt ID A6QL64

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANKRD36 Products

Required fields are marked with *

My Review for All ANKRD36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon