Recombinant Human ANKRD34B protein, GST-tagged
Cat.No. : | ANKRD34B-591H |
Product Overview : | Human ANKRD34B full-length ORF ( ACE86934.1, 1 a.a. - 514 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD34B (Ankyrin Repeat Domain 34B) is a Protein Coding gene. An important paralog of this gene is ANKRD34C. |
Molecular Mass : | 82.94 kDa |
AA Sequence : | MDEGMEISSEGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQSVSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQDHSSYSALVYAINSEDTETLKVLLSACKAKGKEVIIITTAKSPCGKHTTKQYLNMPPVDIDGCHSPATCTTPSEIDIKTASSPLSHSSETELTLFGFKDLELAGSNDDTWDPGSPVRKPALAPKGPKLPHAPPWVKSPPLLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDVKDTAHLLRAFDQASSRKMSYDEINCQSYLSEGNQQCIEVPVDQDPDSNQTIFASTLRSIVQKRNLGANHYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLEGRGSGAFPLDHSVTQTRQGFLPPLNVNSHPPISDINVNNKICSLLSCGQKVLMPTVPIFPKEFKSKKMLLRRQSLQTEQIKQLVNF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD34B ankyrin repeat domain 34B [ Homo sapiens ] |
Official Symbol | ANKRD34B |
Synonyms | DP58 |
Gene ID | 340120 |
mRNA Refseq | NM_001004441.2 |
Protein Refseq | NP_001004441.2 |
UniProt ID | A5PLL1 |
◆ Recombinant Proteins | ||
ANKRD34B-1669M | Recombinant Mouse ANKRD34B Protein | +Inquiry |
ANKRD34B-330R | Recombinant Rhesus monkey ANKRD34B Protein, His-tagged | +Inquiry |
ANKRD34B-2475H | Recombinant Human ANKRD34B Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD34B-591H | Recombinant Human ANKRD34B protein, GST-tagged | +Inquiry |
ANKRD34B-158R | Recombinant Rhesus Macaque ANKRD34B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD34B Products
Required fields are marked with *
My Review for All ANKRD34B Products
Required fields are marked with *
0
Inquiry Basket