Recombinant Human ANKRD29 protein, GST-tagged

• Cat.No.: ANKRD29-587H
• Product Overview: Human ANKRD29 full-length ORF (BAC85555.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANKRD29 (Ankyrin Repeat Domain 29) is a Protein Coding gene. An important paralog of this gene is KIDINS220.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.5 kDa
• AA Sequence: MVAAYAGHIDCVRELVLQGADINLQREDGGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRTGQRPCGSRPRWATARWCGCCCCAEPTATLRGTMAQQHY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD29 ankyrin repeat domain 29 [ Homo sapiens ]
• Official Symbol: ANKRD29
• Synonyms: ANKRD29; ankyrin repeat domain 29; ankyrin repeat domain-containing protein 29
• Gene ID: 147463
• mRNA Refseq: NM_173505.2
• Protein Refseq: NP_775776.2
• UniProt ID: Q8N6D5