Recombinant Human ANGPTL8 protein

Cat.No. : ANGPTL8-190H
Product Overview : Recombinant human Betatrophin cDNA ( 177aa ) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence : MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGAPMGGPEL AQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDI LQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVA QQHRLRQIQERLHTAALPA
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human Betatrophin signaling pathway regulation study for human pancreatic beta cell differentiation.2. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Publications :
Recombinant betatrophin (Angptl‑8/lipasin) ameliorates streptozotocin‑induced hyperglycemia and β‑cell destruction in neonatal rats (2019)
Gene Name ANGPTL8 angiopoietin like 8 [ Homo sapiens ]
Official Symbol ANGPTL8
Synonyms RIFL; TD26; PRO1185; PVPA599; C19orf80; angiopoietin-like 8; betatrophin variant 1; betatrophin variant 2; hepatocellular carcinoma-associated gene TD26; hepatocellular carcinoma-associated protein TD26; lipasin; refeeding-induced fat and liver protein
Gene ID 55908
mRNA Refseq NM_018687
Protein Refseq NP_061157
MIM 616223
UniProt ID Q6UXH0
Chromosome Location 19p13.2
Function hormone activity; hormone activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANGPTL8 Products

Required fields are marked with *

My Review for All ANGPTL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon