Recombinant Human ANGPTL7 Protein, His-tagged

• Cat.No.: ANGPTL7-092H
• Product Overview: Recombinant human ANGPTL7 protein with His tag was expressed in HEK293.

Specification

• Description: Enables identical protein binding activity. Involved in negative regulation of vasculature development involved in avascular cornea development in camera-type eye and regulation of extracellular matrix organization. Located in extracellular region.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized
• Molecular Mass: 39 kDa
• Protein length: 346
• AA Sequence: MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: ANGPTL7 angiopoietin-like 7 [ Homo sapiens (human) ]
• Official Symbol: ANGPTL7
• Synonyms: ANGPTL7; angiopoietin-like 7; angiopoietin-related protein 7; AngX; CDT6; angiopoietin-like protein 7; angiopoietin-like factor (CDT6); cornea-derived transcript 6 protein; dJ647M16.1; RP4-647M16.2
• Gene ID: 10218
• mRNA Refseq: NM_021146
• Protein Refseq: NP_066969
• MIM: 618517
• UniProt ID: O43827