Recombinant Human ANGPTL7 protein, GST-tagged

• Cat.No.: ANGPTL7-560H
• Product Overview: Human ANGPTL7 full-length ORF ( AAH01881, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANGPTL7 (Angiopoietin Like 7) is a Protein Coding gene. An important paralog of this gene is ANGPT4.
• Molecular Mass: 63.8 kDa
• AA Sequence: MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANGPTL7 angiopoietin-like 7 [ Homo sapiens ]
• Official Symbol: ANGPTL7
• Synonyms: ANGPTL7; angiopoietin-like 7; angiopoietin-related protein 7; AngX; CDT6; angiopoietin-like protein 7; angiopoietin-like factor (CDT6); cornea-derived transcript 6 protein; dJ647M16.1; RP4-647M16.2
• Gene ID: 10218
• mRNA Refseq: NM_021146
• Protein Refseq: NP_066969
• UniProt ID: O43827