Recombinant Human ANGPTL3 Protein
Cat.No. : | ANGPTL3-485H |
Product Overview : | Recombinant human ANGPTL3 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 460 |
Description : | This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. |
Form : | Lyophilized |
AA Sequence : | MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | ANGPTL3 angiopoietin-like 3 [ Homo sapiens (human) ] |
Official Symbol | ANGPTL3 |
Synonyms | ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2; |
Gene ID | 27329 |
mRNA Refseq | NM_014495 |
Protein Refseq | NP_055310 |
MIM | 604774 |
UniProt ID | Q9Y5C1 |
◆ Recombinant Proteins | ||
ANGPTL3-1785HFL | Recombinant Full Length Human ANGPTL3 Protein, C-Flag-tagged | +Inquiry |
ANGPTL3-2199H | Active Recombinant Human ANGPTL3 protein, His-tagged | +Inquiry |
ANGPTL3-485H | Recombinant Human ANGPTL3 Protein | +Inquiry |
Angptl3-174M | Active Recombinant Mouse Angptl3 Protein, N-HA-tagged | +Inquiry |
ANGPTL3-401M | Recombinant Mouse Angiopoietin-like 3, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL3-8862HCL | Recombinant Human ANGPTL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL3 Products
Required fields are marked with *
My Review for All ANGPTL3 Products
Required fields are marked with *
0
Inquiry Basket